PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462961738
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family HB-other
Protein Properties Length: 331aa    MW: 35725.7 Da    PI: 9.6104
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462961738genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox535.8e-171171561756
                HHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox  17 elFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                ++F+++++p++++r eL+k+l+L+ rqVk+WFqNrR+++k
  462961738 117 RVFKECPHPDEKQRMELSKRLNLESRQVKFWFQNRRTQMK 156
                79***********************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.0E-8109162IPR001356Homeobox domain
PROSITE profilePS5007113.896115158IPR001356Homeobox domain
SuperFamilySSF466891.24E-13117156IPR009057Homeodomain-like
CDDcd000861.44E-13117156No hitNo description
Gene3DG3DSA:1.10.10.602.9E-15117157IPR009057Homeodomain-like
PfamPF000462.2E-14117156IPR001356Homeobox domain
PROSITE patternPS000270133156IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MSFGGMFDGA GSGVFSYDAG AGMLNPGRLM PSPPIPKRPG RLRALTCYLQ TNMDGGGQLG  60
DVSRLGLMGS GGSGSVGDGD SPVRRRARPG QQQPAQEEEA LPPPHPAANP GTRGVSRVFK  120
ECPHPDEKQR MELSKRLNLE SRQVKFWFQN RRTQMKVLRT ELHRSVNPST TCAGRTTQIE  180
RHENALLRQE NDKLRADNMT IREAMRSPMC ANCGGAAVLG EVSLEEQHLR IENARLKDEL  240
DRVCALARKF LGRPTSSGSP ALSLPGLESS AYVLTRYSPS SATTAQLISR RVSCPCDAMA  300
VLASPDLMTA ITPHGAAACG ARPQCASYVR I
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3657946e-94AK365794.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2037M19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002462701.11e-92hypothetical protein SORBIDRAFT_02g030470
SwissprotQ7Y0V71e-84ROC6_ORYSJ; Homeobox-leucine zipper protein ROC6
TrEMBLC5X6401e-92C5X640_SORBI; Putative uncharacterized protein Sb02g030470
STRINGSb02g030470.13e-92(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP5111922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.14e-62homeodomain GLABROUS 1